- Recombinant Xenopus tropicalis Germ cell-specific gene 1-like protein (gsg1l)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1243533
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 36,609 Da
- E Coli or Yeast
- 1-322
- GSG1-like
- Germ cell-specific gene 1-like protein (gsg1l)
Sequence
MELSRRNRSLLSVVLNLLALSFSVAAFFTSYWCEGTHKVVKPPCLSAVKSKNCQALALNSSSTGSDATDTNGTLNPNVVHYNWETGDDKYAFKYFHTGFWFSCEKHQGEEACRSFIELSPDSEKGVLWLSVISEFLYIILLSLGFLLMCLEFFSSSNFIDGLKINAFAAIITVLSGLLGMVAHMMYMTVFQVTVNLGPKDWRPQTWYYGWSFGLAWLSFTLCMSASVLTLNTYTKTILEFKYRRRIFEKNVRECNPFLDPEMVRFLWEKYIFSVSSTVEDPFNWHKGFGSPIFVDIGSITDLPGAVKEEERGMDLEDDGDQC